PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G26690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 301aa    MW: 34131.6 Da    PI: 5.6443
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G26690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.2e-56211471128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdee+v++yL++k++++++++  vi++v+++++ePwdLp+k+k +ekew+fF+++d+ky+tg r+nrat+sgyWkatgkdke+++
  OGLUM07G26690.1  21 LPPGFRFHPTDEEVVTHYLTRKAQDRSFSC-VVIADVNLNNCEPWDLPSKAKMGEKEWFFFCHKDRKYPTGMRTNRATASGYWKATGKDKEIFR 113
                      79**************************99.78***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g lvg+kktLvfy grap+gekt Wvmheyrl
  OGLUM07G26690.1 114 GRGLLVGMKKTLVFYMGRAPRGEKTPWVMHEYRL 147
                      9*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6318171IPR003441NAC domain
PROSITE profilePS5100557.85621171IPR003441NAC domain
PfamPF023654.5E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MSESEVSVIN QLEEEETRLE LPPGFRFHPT DEEVVTHYLT RKAQDRSFSC VVIADVNLNN  60
CEPWDLPSKA KMGEKEWFFF CHKDRKYPTG MRTNRATASG YWKATGKDKE IFRGRGLLVG  120
MKKTLVFYMG RAPRGEKTPW VMHEYRLDGK LPPNLPRSAK EEWAVCRVFN KDLAAKIAQM  180
PPPPFPRNDS FDLDLDDFLH LDADLPPLID DPFASTSTLK TEPPPPANLM HNHYGYFPLP  240
ASATNYNHSS GAMADQAIRR FCKAEASTAC FSGADADVDP VVDELLSFPD SITDYSYIWK  300
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-551717613170NAC domain-containing protein 19
4dul_A8e-551717613170NAC domain-containing protein 19
1ut7_B8e-551717613170NO APICAL MERISTEM PROTEIN
1ut7_A8e-551717613170NO APICAL MERISTEM PROTEIN
1ut4_B8e-551717613170NO APICAL MERISTEM PROTEIN
1ut4_A8e-551717613170NO APICAL MERISTEM PROTEIN
3swp_D9e-551717616173NAC domain-containing protein 19
3swp_C9e-551717616173NAC domain-containing protein 19
3swp_B9e-551717616173NAC domain-containing protein 19
3swp_A9e-551717616173NAC domain-containing protein 19
3swm_D9e-551717616173NAC domain-containing protein 19
3swm_C9e-551717616173NAC domain-containing protein 19
3swm_B9e-551717616173NAC domain-containing protein 19
3swm_A9e-551717616173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0738760.0AK073876.1 Oryza sativa Japonica Group cDNA clone:J033072L16, full insert sequence.
GenBankAK1056450.0AK105645.1 Oryza sativa Japonica Group cDNA clone:001-200-F06, full insert sequence.
GenBankCT8415730.0CT841573.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C105A13, full insert sequence.
GenBankCU4055640.0CU405564.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C110F22, full insert sequence.
GenBankJN1854440.0JN185444.1 Oryza sativa Japonica Group NAC transcription factor 15 (NAC15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647863.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLR32e-83NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0E0APF00.0A0A0E0APF0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA023698-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g48550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.22e-83Arabidopsis NAC domain containing protein 87